Blog.
Hi, my name is Marco. Working as a Senior Software Architect at Philips. I'm an Opensource Maintainer and Contributor. If you like my work, consider to sponsor my work.
I wrote my first blog March 2011. Mostly I'm writing on software development. In total I wrote 75 articles in 7 categories. Use search below to filter by title or click a category or tag to filter by tag or category.
Categories:
Tags:
zero-trustspiffevaultsigstoredockerslsagithubgithelmkubernetestraefikterraformsshreactnext.jshexoblogmarkdownnginxelasticsearchwebtlsletsencrypthttp/2windowsraspberry piraspbiantesttddbenchmarkconcurrencyparallelismbootchocolateygradlejavahtml5pwaseoperformancevirtualboxangularnode.jsazurehaproxysynologyvagranthyper-vbddjasminemochakarmaputtydebianpacker.iochaigruntsinonnpmjenkinsmsbuildmspecopencovernugetarchitecturec#cqrsdesign patternsfluent securityjsonknockoutjsmicrosoftpowershellwindows 8windows phonewindsormvvmmvc3securityentity frameworklinqvhdconvincingelevator pitchsoftskillsamdjqueryncqrsdiskpartvdiskdddfakeiteasyunittestingdependency injectionkinect
Stories
Pitfall in FakeItEasy
MF
Marco Franssen /
The current project I'm doing is a CQRS based project, using the ncqrs framework. Today I came to a phase I needed some mocking done for some of my domain services. I choose FakeItEasy to handle this for me. So I started by just adding a reference to my DomainScenario project using a Nuget package. For some of my complexer scenario's I ran into some issues which took me about about 45 minutes to fix one of my tests. For fixing all other failing tests I had to do the same trick. Before I explai…